Loading...
Statistics
Advertisement

Brother Seeker | Connecting members of the Church of Christ
www.brotherseeker.com/

Brotherseeker.com

Advertisement
Brotherseeker.com is hosted in United States / Houston . Brotherseeker.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Html, Number of used javascripts: 6. First javascripts: Jquery.js, Jquery-migrate.min.js, Masonry.min.js, Number of used analytics tools: 0. Number of used plugins, modules: 1. Its server type is: nginx/1.10.1. Its CMS is: Wordpress.

Technologies in use by Brotherseeker.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 6
  • jquery.js
  • jquery-migrate.min.js
  • masonry.min.js
  • jquery.masonry.min.js
  • functions.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • nginx/1.10.1

Used plugins, modules

Number of plugins and modules: 1
  • jetpack

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Brotherseeker.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HostGator.com, LLC./OU=PositiveSSL Wildcard/CN=*.websitewelcome.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HostGator.com, LLC.
        • 2: PositiveSSL Wildcard
      • CN: *.websitewelcome.com
    • hash: b86b2c33
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 73802823338622261546480845931487065049
    • validFrom: 151016000000Z
    • validTo: 181015235959Z
    • validFrom_time_t: 1444953600
    • validTo_time_t: 1539647999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 11:37:8F:56:DC:AF:E0:18:CB:07:A7:02:00:3C:DE:8C:B8:11:F4:3A
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.websitewelcome.com, DNS:websitewelcome.com

Meta - Brotherseeker.com

Number of occurences: 3
  • Name:
    Content:
  • Name: viewport
    Content: width=device-width
  • Name: generator
    Content: WordPress 4.5.3

Server / Hosting

  • IP: 192.185.12.202
  • Latitude: 29.93
  • Longitude: -95.54
  • Country: United States
  • City: Houston

Rname

  • dns2.name-services.com
  • dns5.name-services.com
  • dns1.name-services.com
  • dns4.name-services.com
  • dns3.name-services.com

Target

  • info.name-services.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx/1.10.1 Date: Mon, 15 Aug 2016 14:08:18 GMT Content-Type: text/html; charset=UTF-8 Content-Length: 0 Vary: Cookie Location: http://brotherseeker.com/ X-Cache: MISS from s_mf18 X-Cache-Lookup: MISS from s_mf18:80 Via: 1.1 s_mf18 (squid/3.5.9) Connection: keep-alive HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Mon, 15 Aug 2016 14:08:19 GMT Content-Type: text/html; charset=UTF-8 Vary: Cookie Link: ; rel="https://api.w.org/" X-Cache: MISS from s_mf18 X-Cache-Lookup: MISS from s_mf18:80 Transfer-Encoding: chunked Via: 1.1 s_mf18 (squid/3.5.9) Connection: keep-alive

DNS

host: brotherseeker.com
  1. class: IN
  2. ttl: 1800
  3. type: A
  4. ip: 192.185.12.202
host: brotherseeker.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns2.name-services.com
host: brotherseeker.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns5.name-services.com
host: brotherseeker.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns1.name-services.com
host: brotherseeker.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns4.name-services.com
host: brotherseeker.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns3.name-services.com
host: brotherseeker.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: dns1.name-services.com
  5. rname: info.name-services.com
  6. serial: 1446773451
  7. refresh: 172800
  8. retry: 900
  9. expire: 1814400
  10. minimum-ttl: 3600

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.rotherseeker.com, www.bqrotherseeker.com, www.qrotherseeker.com, www.bwrotherseeker.com, www.wrotherseeker.com, www.bzrotherseeker.com, www.zrotherseeker.com, www.bxrotherseeker.com, www.xrotherseeker.com, www.brotherseeker.com, www.rotherseeker.com, www.bsrotherseeker.com, www.srotherseeker.com, www.byrotherseeker.com, www.yrotherseeker.com, www.berotherseeker.com, www.erotherseeker.com, www.bdrotherseeker.com, www.drotherseeker.com, www.bcrotherseeker.com, www.crotherseeker.com, www.botherseeker.com, www.briotherseeker.com, www.biotherseeker.com, www.brootherseeker.com, www.bootherseeker.com, www.brlotherseeker.com, www.blotherseeker.com, www.brlotherseeker.com, www.blotherseeker.com, www.br.otherseeker.com, www.b.otherseeker.com, www.brtherseeker.com, www.brobtherseeker.com, www.brbtherseeker.com, www.brohtherseeker.com, www.brhtherseeker.com, www.brogtherseeker.com, www.brgtherseeker.com, www.brojtherseeker.com, www.brjtherseeker.com, www.bromtherseeker.com, www.brmtherseeker.com, www.bro therseeker.com, www.br therseeker.com, www.brovtherseeker.com, www.brvtherseeker.com, www.broherseeker.com, www.brotqherseeker.com, www.broqherseeker.com, www.brotaherseeker.com, www.broaherseeker.com, www.brot herseeker.com, www.bro herseeker.com, www.brotwherseeker.com, www.browherseeker.com, www.broteherseeker.com, www.broeherseeker.com, www.brotzherseeker.com, www.brozherseeker.com, www.brotxherseeker.com, www.broxherseeker.com, www.brotcherseeker.com, www.brocherseeker.com, www.broterseeker.com, www.brotheerseeker.com, www.broteerseeker.com, www.brothderseeker.com, www.brotderseeker.com, www.brothcerseeker.com, www.brotcerseeker.com, www.brothuerseeker.com, www.brotuerseeker.com, www.brothjerseeker.com, www.brotjerseeker.com, www.brotherseeker.com, www.broterseeker.com, www.brothberseeker.com, www.brotberseeker.com, www.brothgerseeker.com, www.brotgerseeker.com, www.brothrseeker.com, www.brothexrseeker.com, www.brothxrseeker.com, www.brothesrseeker.com, www.brothsrseeker.com, www.brothewrseeker.com, www.brothwrseeker.com, www.brotherrseeker.com, www.brothrrseeker.com, www.brothefrseeker.com, www.brothfrseeker.com, www.brothevrseeker.com, www.brothvrseeker.com, www.brothecrseeker.com, www.brothcrseeker.com, www.brotheqrseeker.com, www.brothqrseeker.com, www.brothearseeker.com, www.brotharseeker.com, www.brotheyrseeker.com, www.brothyrseeker.com, www.brotheseeker.com, www.brotheriseeker.com, www.brotheiseeker.com, www.brotheroseeker.com, www.brotheoseeker.com, www.brotherlseeker.com, www.brothelseeker.com, www.brotherlseeker.com, www.brothelseeker.com, www.brother.seeker.com, www.brothe.seeker.com, www.brothereeker.com, www.brotherseeeker.com, www.brothereeeker.com, www.brothersweeker.com, www.brotherweeker.com, www.brothersdeeker.com, www.brotherdeeker.com, www.brothersxeeker.com, www.brotherxeeker.com, www.brothersfeeker.com, www.brotherfeeker.com, www.brothersgeeker.com, www.brothergeeker.com, www.brothersteeker.com, www.brotherteeker.com, www.brotherseker.com, www.brothersxeker.com, www.brotherseseker.com, www.brothersseker.com, www.brotherseweker.com, www.brothersweker.com, www.brothersereker.com, www.brothersreker.com, www.brothersefeker.com, www.brothersfeker.com, www.brotherseveker.com, www.brothersveker.com, www.brotherseceker.com, www.brothersceker.com, www.brotherseqeker.com, www.brothersqeker.com, www.brotherseaeker.com, www.brothersaeker.com, www.brotherseyeker.com, www.brothersyeker.com, www.brotherseker.com, www.brotherseexker.com, www.brotherseesker.com, www.brothersesker.com, www.brotherseewker.com, www.brothersewker.com, www.brotherseerker.com, www.brotherserker.com, www.brotherseefker.com, www.brothersefker.com, www.brotherseevker.com, www.brothersevker.com, www.brotherseecker.com, www.brothersecker.com, www.brotherseeqker.com, www.brotherseqker.com, www.brotherseeaker.com, www.brotherseaker.com, www.brotherseeyker.com, www.brotherseyker.com,

Other websites we recently analyzed

  1. OUTROXTREME
    Korea, Republic of - 183.111.174.8
    Server software: nginx
    Technology: CSS, Html
    Number of meta tags: 1
  2. Leonardo Almeida | Sposen Realty & Development
    San Antonio (United States) - 67.192.7.83
    Server software: Apache
    Technology: Maxcdn, OSS CDN, CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, jQuery Validate, jQuery UI, Php, Pingback, Wordpress
    Number of Javascript: 38
    Number of meta tags: 3
  3. 63355.xyz
    San Jose (United States) - 23.27.192.115
    Server software: Tengine/1.4.2
    Technology: CloudFront, Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  4. virgingalacticspaceflightsystems.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  5. cheaplouboutinsssstores.com
    Switzerland - 141.8.225.181
    Server software: nginx/1.9.2
    Technology: Html
  6. ITAIM KEIKO - Longevidade no Esporte Tênis de Mesa
    Academia de Tênis de Mesa Especializada
    Houston (United States) - 192.185.217.48
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript
    Number of Javascript: 12
    Number of meta tags: 5
  7. petalumahomesonline.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  8. Intro
    Berlin (Germany) - 81.169.145.151
    Server software: Apache/2.2.31 (Unix)
    Technology: Html
    Number of meta tags: 1
  9. www.superbugs.tv
    Ashburn (United States) - 52.0.217.44
    Server software:
    Technology: CSS, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 2
  10. magazines-america.com
    Scottsdale (United States) - 50.63.202.93
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe

Check Other Websites